DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC8-9 and emc8

DIOPT Version :9

Sequence 1:NP_611731.1 Gene:EMC8-9 / 37635 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_998535.1 Gene:emc8 / 406679 ZFINID:ZDB-GENE-040426-2692 Length:202 Species:Danio rerio


Alignment Length:211 Identity:81/211 - (38%)
Similarity:108/211 - (51%) Gaps:39/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSK----GSQVEIVDAIPLFHQCLYVTPMAEVALM 65
            |::.:||.|::.|||||||.||||||:|||..|    ...|..||.:||||..|.:.||.||||.
Zfish     4 KLTTQAYCKMLLHAAKYPHCAVNGLLVAEKHKKKDNPRDSVLCVDCVPLFHGALALAPMLEVALT 68

  Fly    66 LIDAHAEREGLVIAGYYAAPENFYD---NQVDKTPAAKIADKIQENFKNACFVVVDNKLMTLQ-- 125
            |||...:....||||||.|.|...:   |||    |.|:|.:|.|||..|..:::||...|::  
Zfish    69 LIDTWCKENKYVIAGYYQANERIKETRPNQV----AEKVAARISENFSEAAMIMMDNSRFTMECF 129

  Fly   126 ---------HDRAAIQVFNCPGDSGARWSKAKFTLSQASDTLEG---VSLLLKRGAMRDLVDFDN 178
                     ||.              :|...:.:.....|.||.   .:.||:..:...||||||
Zfish   130 VPVLFIYDHHDN--------------KWKCREPSTDCFEDWLEAQKITAALLENKSYESLVDFDN 180

  Fly   179 HLDNPDKNWTNDFLNQ 194
            |||:...:|||..:|:
Zfish   181 HLDDLRNDWTNPEINK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 77/203 (38%)
emc8NP_998535.1 MPN_UPF0172 5..191 CDD:163691 77/203 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574555
Domainoid 1 1.000 123 1.000 Domainoid score I5532
eggNOG 1 0.900 - - E1_KOG3289
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4690
OMA 1 1.010 - - QHG54791
OrthoDB 1 1.010 - - D1284861at2759
OrthoFinder 1 1.000 - - FOG0002590
OrthoInspector 1 1.000 - - otm25717
orthoMCL 1 0.900 - - OOG6_102725
Panther 1 1.100 - - O PTHR12941
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4556
SonicParanoid 1 1.000 - - X2308
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.