DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC8-9 and Emc8

DIOPT Version :9

Sequence 1:NP_611731.1 Gene:EMC8-9 / 37635 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_035056.1 Gene:Emc8 / 18117 MGIID:1343095 Length:207 Species:Mus musculus


Alignment Length:204 Identity:82/204 - (40%)
Similarity:105/204 - (51%) Gaps:21/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVSERAYAKLIFHAAKYPHQAVNGLLLAEK--------TSKGSQVEIVDAIPLFHQCLYVTPMAE 61
            |::.:||.|::.|.|||||.||||||:||:        ...||....||.|||||..|.:|||.|
Mouse     5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHGTLALTPMLE 69

  Fly    62 VALMLIDAHAEREGLVIAGYYAAPENFYD---NQVDKTPAAKIADKIQENFKNACFVVVDNKLMT 123
            |||.|||:..:....||||||.|.|...|   |||    |.|:|.:|.|.|.:|..::|||...|
Mouse    70 VALTLIDSWCKDNSYVIAGYYQANERVKDASPNQV----AEKVASRIAEGFGDAALIMVDNAKFT 130

  Fly   124 LQHDRAAIQVFNCPGDSGARWSKAKFTLSQASDTLEGVSL---LLKRGAMRDLVDFDNHLDNPDK 185
            :......|.|:.   ....||...........|..|...:   ||...:...|||||||||:...
Mouse   131 MDCAAPTIHVYE---QHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRS 192

  Fly   186 NWTNDFLNQ 194
            :|||..:|:
Mouse   193 DWTNPEINK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 78/196 (40%)
Emc8NP_035056.1 MPN_UPF0172 6..196 CDD:163691 78/196 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831527
Domainoid 1 1.000 122 1.000 Domainoid score I5638
eggNOG 1 0.900 - - E1_KOG3289
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4692
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54791
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002590
OrthoInspector 1 1.000 - - otm43915
orthoMCL 1 0.900 - - OOG6_102725
Panther 1 1.100 - - O PTHR12941
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4556
SonicParanoid 1 1.000 - - X2308
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.