DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC8-9 and F25H2.4

DIOPT Version :9

Sequence 1:NP_611731.1 Gene:EMC8-9 / 37635 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001379176.1 Gene:F25H2.4 / 172938 WormBaseID:WBGene00009118 Length:196 Species:Caenorhabditis elegans


Alignment Length:203 Identity:61/203 - (30%)
Similarity:102/203 - (50%) Gaps:27/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKVSERA--YAKLIFHAAKYPHQAVNGLLLAEKTSKGSQVEIVDAIPLFHQCLYVTPMAEVALML 66
            ::|..:|  |:.:|.|..|||.:.|.|||:..|  ||.:|.:...:||.|:...:.|..|:|..|
 Worm     3 HQVETQALPYSTIILHCLKYPAKGVFGLLIGNK--KGDKVTVTSCVPLCHESTPLAPPLELATAL 65

  Fly    67 IDAHAEREGLVIAGYY---AAPE----NFYDNQVDKTPAAKIADKIQENFKNACFVV-VDNKLMT 123
            :..   :.|..:.|.|   |.|.    |.|        |.::||:|.....:|..:| |.|:.:.
 Worm    66 VHG---KFGASLVGVYFSNATPSDTSLNVY--------ATRLADRISSVTSSAAILVQVMNERLV 119

  Fly   124 LQHDRAAIQVFNCPGDSGARWSKAKFTLSQASDTLEGVSLLLKRGAMRDLVDFDNHLDNPDKNWT 188
            ...::..:..:...|||   |.:.| |:.|.|:.|.|:..::::...|:|.||:||||||:.::.
 Worm   120 SDCEQDRLVAYEKDGDS---WKETK-TIFQGSNFLRGLQAVIQKKLYRELSDFENHLDNPEFDFY 180

  Fly   189 NDFLNQPL 196
            |..|:..|
 Worm   181 NTNLSNKL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 58/193 (30%)
F25H2.4NP_001379176.1 MPN_UPF0172 8..181 CDD:163691 57/189 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156553
Domainoid 1 1.000 82 1.000 Domainoid score I5445
eggNOG 1 0.900 - - E1_KOG3289
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I3756
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54791
OrthoDB 1 1.010 - - D1284861at2759
OrthoFinder 1 1.000 - - FOG0002590
OrthoInspector 1 1.000 - - oto18810
orthoMCL 1 0.900 - - OOG6_102725
Panther 1 1.100 - - LDO PTHR12941
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4556
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.