powered by:
Protein Alignment EMC8-9 and Gm27021
DIOPT Version :9
Sequence 1: | NP_611731.1 |
Gene: | EMC8-9 / 37635 |
FlyBaseID: | FBgn0034791 |
Length: | 203 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001295378.1 |
Gene: | Gm27021 / 105734727 |
MGIID: | 5504136 |
Length: | 156 |
Species: | Mus musculus |
Alignment Length: | 70 |
Identity: | 36/70 - (51%) |
Similarity: | 44/70 - (62%) |
Gaps: | 8/70 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KVSERAYAKLIFHAAKYPHQAVNGLLLAEK--------TSKGSQVEIVDAIPLFHQCLYVTPMAE 61
|::.:||.|::.|.|||||.||||||:||: ...||....||.|||||..|.:|||.|
Mouse 5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHGTLALTPMLE 69
Fly 62 VALML 66
|||.|
Mouse 70 VALTL 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
EMC8-9 | NP_611731.1 |
UPF0172 |
3..188 |
CDD:281640 |
36/70 (51%) |
Gm27021 | NP_001295378.1 |
MPN |
6..>75 |
CDD:301301 |
35/69 (51%) |
DUF4597 |
93..155 |
CDD:292010 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3289 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.