DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC8-9 and Gm27021

DIOPT Version :9

Sequence 1:NP_611731.1 Gene:EMC8-9 / 37635 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001295378.1 Gene:Gm27021 / 105734727 MGIID:5504136 Length:156 Species:Mus musculus


Alignment Length:70 Identity:36/70 - (51%)
Similarity:44/70 - (62%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVSERAYAKLIFHAAKYPHQAVNGLLLAEK--------TSKGSQVEIVDAIPLFHQCLYVTPMAE 61
            |::.:||.|::.|.|||||.||||||:||:        ...||....||.|||||..|.:|||.|
Mouse     5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHGTLALTPMLE 69

  Fly    62 VALML 66
            |||.|
Mouse    70 VALTL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 36/70 (51%)
Gm27021NP_001295378.1 MPN 6..>75 CDD:301301 35/69 (51%)
DUF4597 93..155 CDD:292010
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3289
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.