DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP5K59B and PIPK10

DIOPT Version :9

Sequence 1:NP_001369113.1 Gene:PIP5K59B / 37633 FlyBaseID:FBgn0034789 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001329151.1 Gene:PIPK10 / 828066 AraportID:AT4G01190 Length:411 Species:Arabidopsis thaliana


Alignment Length:389 Identity:108/389 - (27%)
Similarity:186/389 - (47%) Gaps:70/389 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIK 189
            |....:||.:|.|.|:.|...::|.||..||:::|:||....:..:.|..|::|:::.|:.|:||
plant    32 PPGSITEFDWKDYCPVGFGLIQELEGIDHDDYLLSICTDETLKKISSGKIGNVFHISNDNRFLIK 96

  Fly   190 TVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKY 254
            .::..|.:...::||.||.::|.:..:|..:.||.:.::..........||:|:|.|::.::..|
plant    97 ILRKSEIKVTLEMLPRYYRHINYHRSSLFTRIFGAHSVKPLGGVKTYFAVMSNMLHSTIFVNKLY 161

  Fly   255 DLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDY 319
            |||||. |.::||....:.:...||:||    ....:::......:||..:.||.:||...||||
plant   162 DLKGSP-KGRSNKKIEVRNTTVLKDIDF----DFCFYVDPLARQRIIKQTKLDCELLEEEGIMDY 221

  Fly   320 SLLLGVHNLDVALKEKQSEQRKPLRAPLAEDSDVDADDPLDGDAATGISRNKSVNRQRLVAHST- 383
            |||:|       |:.|.|.|           ..:|..:|:.|..|...|...:..:....|.|: 
plant   222 SLLVG-------LQSKGSCQ-----------GSLDGLNPVYGSFAPPSSFKSNSTKSMKTASSSP 268

  Fly   384 -----AMESIQAESEPIDDE-----EDVPPGG---------------------------IPARS- 410
                 ||.|...:.:.:::|     :.|....                           ||||: 
plant   269 DRSSVAMYSCSPDRDSVENEMSMTIQSVTSNSASSETNILATTLSDLFHNSSNINFGMKIPARAR 333

  Fly   411 ----EKGE----RLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMA 466
                |.||    .::|||||:|..|.|.:||::||.:|||.::..::|...|..|:.|||:|::
plant   334 RVTRETGEEEWYNVVLYIGIVDTFQDYGMKKRIEHCYKSIQYNSNSISTVHPKIYSSRFQDFVS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP5K59BNP_001369113.1 PIPKc_PIP5KI 78..473 CDD:340438 108/389 (28%)
PIPK10NP_001329151.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 176 1.000 Domainoid score I1082
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1094
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X284
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.