DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP5K59B and Pip5kl1

DIOPT Version :9

Sequence 1:NP_001369113.1 Gene:PIP5K59B / 37633 FlyBaseID:FBgn0034789 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_017172887.1 Gene:Pip5kl1 / 227733 MGIID:2448520 Length:568 Species:Mus musculus


Alignment Length:304 Identity:74/304 - (24%)
Similarity:128/304 - (42%) Gaps:30/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ASTDHVGNSSPDLGNRPNRASSKADKERKIGHRRVGEGGEITYKKIQTSQIMGSIQLGI-QHTVG 93
            |.:...||.|...|:|.........::.::|...||.|.|:       .::...:|.|: ..|..
Mouse   261 AHSQEAGNKSISSGSRRGLLWHLRARQSRVGLFEVGPGHEL-------HRMTRMMQEGLWAATQV 318

  Fly    94 SLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMM 158
            |..:.|.......|:.|:           :|..|. ..|.....|..||...|...|:..:|:..
Mouse   319 SKNNPPTGPTTQKDYLEV-----------MTQVHE-EGFELGTLAGPAFARLRKSIGLTEEDYQA 371

  Fly   159 SMCT-SPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFF 222
            ::.. .|..:..:...|.:.|:||.|..|.:||.:..|...|...||.|..:|.|.|.:||.:..
Mouse   372 TLGPGDPYLQFFSTSKSKASFFLTHDQRFFVKTQRRHEVHVLLAHLPRYVEHLQQYPHSLLARLL 436

  Fly   223 GLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSP---TYKDLDFME 284
            |:|.|:.:..|....::|..:...:.::..:||:||....|..:.|...  ||   ..|||:|.|
Mouse   437 GVYSLRVAQGKKKYFIIMQCIFYPTSRISERYDIKGCNISRWVDPAPEG--SPLVLVLKDLNFQE 499

  Fly   285 QHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNL 328
            :   .:.|.|:. :..::.::.|...|....::|||||:.:..|
Mouse   500 K---TMRLGAQR-SWFLRQMELDTAFLREVNVLDYSLLVAIQFL 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP5K59BNP_001369113.1 PIPKc_PIP5KI 78..473 CDD:340438 63/256 (25%)
Pip5kl1XP_017172887.1 PIPKc 299..>543 CDD:391950 64/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.