DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP5K59B and PIKFYVE

DIOPT Version :9

Sequence 1:NP_001369113.1 Gene:PIP5K59B / 37633 FlyBaseID:FBgn0034789 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_011509080.1 Gene:PIKFYVE / 200576 HGNCID:23785 Length:2110 Species:Homo sapiens


Alignment Length:502 Identity:113/502 - (22%)
Similarity:183/502 - (36%) Gaps:150/502 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TINTIDMDSSSASQAKLAEPSNASTDHVGNSSPD---------------LGNRPNRASSKADKER 57
            |.:|.|....|:|..:|.|.|...|:....:.|.               .|..|:.:|.|.:..|
Human  1714 TNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKASGMLSFFRGTAGKSPDLSSQKRETLR 1778

  Fly    58 KIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSS 122
                     |.:..|.::..:...|:...|::         |:.::...|..:.:.|. |.....
Human  1779 ---------GADSAYYQVGQTGKEGTENQGVE---------PQDEVDGGDTQKKQLIN-PHVELQ 1824

  Fly   123 LTPAHHYSEFRYKIYAPIAFRYFRD-LFGIQPDDFMMSMC-TSPLRELSNPGASGSIFYLTTDDE 185
            .:.|:  ::|..::|....|...|: :.....:||:.|:. :||.:  :..|.||:.||.|.||.
Human  1825 FSDAN--AKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQ--ARGGKSGAAFYATEDDR 1885

  Fly   186 FIIKTVQHKEGEFLQKLLPGYY---MNLNQNPR-TLLPKFFGLYCL-----QTSNAKNIRLVVMN 241
            ||:|.:...|.:......|.|:   .|..|..| |.|.|..|:|.:     |.:..|.:.|:||.
Human  1886 FILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVME 1950

  Fly   242 NLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQH------PNGIFLEAETYAAL 300
            ||.... ||...:|||||...|.. |.:..|:|   .|:..::::      .|.:::.:.:.|.|
Human  1951 NLFYGR-KMAQVFDLKGSLRNRNV-KTDTGKES---CDVVLLDENLLKMVRDNPLYIRSHSKAVL 2010

  Fly   301 IKTIQRDCTVLESFKIMDYSLLLGVHNLDVALKEKQSEQRKPLRAPLAEDSDVDADDPLDGDAAT 365
            ..:|..|...|.|..|:|||||:|                              .||        
Human  2011 RTSIHSDSHFLSSHLIIDYSLLVG------------------------------RDD-------- 2037

  Fly   366 GISRNKSVNRQRLVAHSTAMESIQAESEPIDDEEDVPPGGIPARSEKGERLLLYIGIIDILQSYR 430
                             |:.|                               |.:||||.::::.
Human  2038 -----------------TSNE-------------------------------LVVGIIDYIRTFT 2054

  Fly   431 LKKKLEHTFKS---IIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIP 474
            ..||||...||   :...|:..:|..|..|..||...|.| .|..:|
Human  2055 WDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDK-YFLMVP 2100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP5K59BNP_001369113.1 PIPKc_PIP5KI 78..473 CDD:340438 95/414 (23%)
PIKFYVEXP_011509080.1 FYVE_PIKfyve_Fab1 166..227 CDD:277264
DEP_PIKfyve 369..450 CDD:239895
Fab1_TCP 629..889 CDD:239450
PIPKc 1784..2097 CDD:238081 95/418 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.