DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP5K59B and PIP5KL1

DIOPT Version :9

Sequence 1:NP_001369113.1 Gene:PIP5K59B / 37633 FlyBaseID:FBgn0034789 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001128691.1 Gene:PIP5KL1 / 138429 HGNCID:28711 Length:394 Species:Homo sapiens


Alignment Length:448 Identity:101/448 - (22%)
Similarity:182/448 - (40%) Gaps:75/448 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAEPSNASTDHVGNSSPDLGNRPNRASSKA------DKERKIGHRRVGEGGEI-TYKKIQTSQIM 81
            :|.||....: |...||:.|.|...:|.:.      ||:.::|...:..|.|: ....:..:.:.
Human     1 MAAPSPGPRE-VLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQAGLW 64

  Fly    82 GSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFR 146
            .:.|:.:.|..   ...|.||    ||.|:           ||..|  ..|.....|..||.:.|
Human    65 AATQVSMDHPP---TGPPSRD----DFSEV-----------LTQVH--EGFELGTLAGPAFAWLR 109

  Fly   147 DLFGIQPDDFMMSMCT-SPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNL 210
            ...|:..:|:..::.. .|..:..:...|.:.|:|:.|..|.:||...:|.:.|...||.|..:|
Human   110 RSLGLAEEDYQAALGPGGPYLQFLSTSKSKASFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHL 174

  Fly   211 NQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSP 275
            .::|.:||.:..|::.|:....|....:||.::...:.::..:||:||....|..:.|...  ||
Human   175 QRHPHSLLARLLGVHSLRVDRGKKTYFIVMQSVFYPAGRISERYDIKGCEVSRWVDPAPEG--SP 237

  Fly   276 ---TYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVALKEKQS 337
               ..|||:|..:..|    .....:..::.::.|.|.|....::|||||       :|.:....
Human   238 LVLVLKDLNFQGKTIN----LGPQRSWFLRQMELDTTFLRELNVLDYSLL-------IAFQRLHE 291

  Fly   338 EQRKPLRAPLAEDSDVDADDPLDGDAATGISRNKSVNRQRLVAHSTAMESIQAESEPIDDEEDVP 402
            ::|.|       .|.:..........|.....:::.||:.|.....|:..:.             
Human   292 DERGP-------GSSLIFRTARSVQGAQSPEESRAQNRRLLPDAPNALHILD------------- 336

  Fly   403 PGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQR 460
                      |.....::|::|:...|.|:|:|||.:|::.:.|.|.|...|:.||:|
Human   337 ----------GPEQRYFLGVVDLATVYGLRKRLEHLWKTLRYPGRTFSTVSPARYARR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP5K59BNP_001369113.1 PIPKc_PIP5KI 78..473 CDD:340438 87/387 (22%)
PIP5KL1NP_001128691.1 PIP5K 128..392 CDD:279801 69/300 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.