DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and zgc:172120

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001121748.1 Gene:zgc:172120 / 799440 ZFINID:ZDB-GENE-080204-46 Length:273 Species:Danio rerio


Alignment Length:231 Identity:52/231 - (22%)
Similarity:82/231 - (35%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLDCEVEIGPREQGFVLKWLFNN-----HSIYQWIPSVKGFAMGFMKSKID---------TKIFT 99
            ||.||..........|:.|....     ||.|            :.:.:::         |.:|.
Zfish    34 VLGCEFTPDLNLSNLVVTWQREEDSQVVHSFY------------YQQDQLERQSPEYHSRTSLFV 86

  Fly   100 MEGSPGVISIK--NPDWNMTGEYTCAVQTFESTDKRSARLQIIVPESDFMLEARMSGSRMDVDIM 162
            .|...|..||:  ...|...|.|.|.|...:.|.:.|..:......|:..|...::.|.:.|:. 
Zfish    87 TELHKGNASIRIAAVSWKDAGRYLCIVSNTKGTGRASMEVTYGALYSEPRLSIHLNSSALTVEF- 150

  Fly   163 CAVQHVFPQPMLSVMFDTH--ILDSVLTQLDQDPSGLYSMTVRTRIPRDQLESPTPITCAFILVG 225
              ....||:|.: :..|.|  .|...|..|.....|||.:..|..: :.|:.:.| .|....|:.
Zfish   151 --ETEGFPKPEV-IWVDEHDQTLSCPLELLKHTEDGLYLIKSRYEV-KKQVVNVT-FTLKNHLLN 210

  Fly   226 TNYTKRRETIFYDKASTIQRKWTTVAVVMSIASLAL 261
            .| ..|..|..||: :......|...||:|:..:.|
Zfish   211 QN-IHRPVTFSYDE-NIKSNPGTATVVVLSLVCIVL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
zgc:172120NP_001121748.1 IG_like 23..127 CDD:214653 22/104 (21%)
Ig 30..126 CDD:299845 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.