DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and LOC797620

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_001338090.3 Gene:LOC797620 / 797620 -ID:- Length:268 Species:Danio rerio


Alignment Length:266 Identity:56/266 - (21%)
Similarity:98/266 - (36%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAVLALLSVTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKW-----LFNNH 72
            :|..|.|.::.....:.::.|| :|.:........| |.|..|........|:.|     :...|
Zfish     1 MLFFLLLWTLLQCADLFSVNVP-SYPVLAVRGATAL-LSCFFESDSNPSSLVITWQRVEDMRVVH 63

  Fly    73 SIYQWIPSVKGFAMGFMKSKIDTKIFTMEGSPGVISIKNPDWNM--TGEYTCAVQTFESTDKRSA 135
            |.|.....:|..:..:...   |.:...|.:.|..|:....:.:  .|.|.|.|...:.|||.:.
Zfish    64 SYYHQKDQLKRQSADYFNR---THLNYNETAKGNASLSIASFGLKDAGIYECVVSNTKGTDKGTL 125

  Fly   136 RLQIIVPESDFMLEARMSGSRMDVDIMCAVQHV---FPQP-MLSVMFDTHILDSVLTQLDQDPSG 196
            :|....|.|:..|...:..|.:      .||:.   ||:| :|.:......|.:.....:....|
Zfish   126 QLIYAAPYSEPRLSIHLKSSNV------TVQYETEGFPKPEVLWLNSGGQNLTNHQEVSNTSDEG 184

  Fly   197 LYSMTVRTRIPRDQLESPTP-ITCAFILVGT---NYTKRRETIFYDKASTIQRKWTTVAVVMSIA 257
            ||.:       :....:..| |...|:|..|   ...:|...:.:|:.   |...::|||:..:.
Zfish   185 LYYL-------KSSYVTENPAINITFMLKNTVAHQELQRHLILNFDEG---QSSSSSVAVLSVLC 239

  Fly   258 SLALSS 263
            |..|.|
Zfish   240 SCLLLS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
LOC797620XP_001338090.3 Ig 36..119 CDD:325142 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.