DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and zgc:153911

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001070783.1 Gene:zgc:153911 / 768172 ZFINID:ZDB-GENE-061013-174 Length:288 Species:Danio rerio


Alignment Length:277 Identity:62/277 - (22%)
Similarity:98/277 - (35%) Gaps:87/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRVPRTYTL-FRDHEPDPLVLDCEVEIGPREQGF-----VLKW---LFNNHSIYQWIPSVKGFAM 86
            :.|||:..: |...|   |:|.|..   |.:..:     |:.|   |...||.|           
Zfish    23 ISVPRSPVIGFYGEE---LILPCTF---PVDSSWDLSSTVITWQRGLDVVHSFY----------- 70

  Fly    87 GFMKSKID---------TKIFTMEGSPGVISIK--NPDWNMTGEYTCAVQTFESTDKRSARLQII 140
             :.:.::|         |.:|..|...|..|:|  .......|.|||::.|...:.|:|..:.|.
Zfish    71 -YSRDQLDRQNPHYVSRTSLFIQEMQRGNASLKLDKVTQRDAGVYTCSISTNSGSQKKSFAVNIA 134

  Fly   141 VPESDFMLEARMSGSRM--DVDIMCAVQHVFPQPMLS-VMFDTHILDSVLTQLDQDPS-GLY--- 198
            ...|    |.|:..|.:  .|:::......:|.|.|. :|.::.|.:...|.|.||.| |||   
Zfish   135 ALYS----EPRLQFSMLTDGVNLLVTSDGGYPSPTLQWLMENSDITNQTQTHLRQDTSTGLYIVS 195

  Fly   199 -----------SMT-----------VRTRI--PRDQLESPTPITC--------------AFILVG 225
                       |:|           :|..|  ..|::|......|              |.:|:.
Zfish   196 SWIKLSDVSNSSLTFILHNKPLGQDIRREIQLSSDKIEKQEENRCSECFILIPVALLLLAMVLLF 260

  Fly   226 TNYTKRRETIFYDKAST 242
            ..:.|||......|.|:
Zfish   261 VFFIKRRRKAEKSKQSS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
zgc:153911NP_001070783.1 V-set 28..122 CDD:284989 24/111 (22%)
IG_like 35..133 CDD:214653 25/115 (22%)
Ig <156..221 CDD:299845 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.