DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and Skint1

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001129388.1 Gene:Skint1 / 689801 RGDID:1587579 Length:377 Species:Rattus norvegicus


Alignment Length:261 Identity:41/261 - (15%)
Similarity:77/261 - (29%) Gaps:86/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVLDCEVEIGPREQGFVLKWLFN----------------NHSIYQWIPSVKGFAMGFMKSKIDTK 96
            |.|.|::....:.|...::|..|                ...|.:::...:....|..:.|:..:
  Rat    45 LELSCQLSPPQQAQHMEIRWFRNLYREPVHLYRDGKDMFGEIISKYVERTELLKDGIGEGKVTLR 109

  Fly    97 IFTMEGSPGVISIKNPDWNMT----GEYTCAVQTFESTDKRSARLQIIVPESDF----MLEARMS 153
            |:                |:|    |.|.|                 :..|.||    :.|.:::
  Rat   110 IY----------------NVTVDDDGFYHC-----------------VFKEGDFYEEHITEVKVT 141

  Fly   154 GSRMDVDIMCAVQHVFPQPMLSVMFDTH------------------ILDSVLTQLDQDPSGLYSM 200
            ...:.|.|     ||.|.....|:.:.|                  ::.:......|....|::|
  Rat   142 AINLRVQI-----HVHPPNTKGVIVECHSGGWFPRPLMEWRDSRGEVIPAASKSHSQGGDRLFNM 201

  Fly   201 TVRTRIPRDQLESPTPITCAFILVGTNYTKRRETIFYDKASTIQRKWTT---VAVVMSIASLALS 262
            .:...|.....:.   |||......|....|...|..|...:....|..   :.:.:.:.|:.:|
  Rat   202 KISLLISDSSFQK---ITCCLQNPLTGQEGRTSVILSDAFFSWNIIWKMILGIILFVMVLSILVS 263

  Fly   263 S 263
            |
  Rat   264 S 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
Skint1NP_001129388.1 IGv domain 27..141 19/128 (15%)
IG_like 36..140 CDD:214653 19/127 (15%)
Ig_MOG_like 42..141 CDD:143190 19/128 (15%)
Ig 107..217 CDD:299845 22/150 (15%)
IGc domain 142..228 15/93 (16%)
transmembrane domain 1 247..269 3/18 (17%)
transmembrane domain 2 282..304
transmembrane domain 3 326..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.