DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and Skint1

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001096132.1 Gene:Skint1 / 639781 MGIID:3649627 Length:364 Species:Mus musculus


Alignment Length:257 Identity:38/257 - (14%)
Similarity:80/257 - (31%) Gaps:84/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVLDCEVEIGPREQGFVLKWLFNNHS----------------IYQWIPSVKGFAMGFMKSKIDTK 96
            |.|.|::....:.|...::|..|.::                |.:::...:....|..:.|:..:
Mouse    45 LELSCQLSPPQQAQHMEIRWFRNLYTEPVHLYRDGKDMFGEIISKYVERTELLKDGIGEGKVTLR 109

  Fly    97 IFTMEGSPGVISIKNPDWNMT----GEYTCAVQTFESTDKRSARLQIIVPESDF----MLEARMS 153
            ||                |:|    |.|.|                 :..:.||    :.|.:::
Mouse   110 IF----------------NVTVDDDGSYHC-----------------VFKDGDFYEEHITEVKIT 141

  Fly   154 GSRMDVDIMCAVQHVFPQPMLSVMFDTH------------------ILDSVLTQLDQDPSGLYSM 200
            ...:.|.|     ||.|.....|:.:.|                  ::.:......|....|::|
Mouse   142 AINLQVQI-----HVHPPNTKGVIVECHSGGWFPRPLMQWRDRRGEVIPAASKSHSQGRDKLFNM 201

  Fly   201 TVRTRIPRDQLESPTPITCAFILVGTNYTKRRETIFYDKASTIQRKWTTV-AVVMSIASLAL 261
            .:...|.....:.   :.|......|...:|...|..|...:..|.|..: .:::|:..:::
Mouse   202 KISLLISESFFQK---VICCLQNPLTGQEERTSVILSDAFFSWNRIWKMILGIILSMMVVSI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
Skint1NP_001096132.1 IGv domain 27..141 19/128 (15%)
IG_like 35..140 CDD:214653 19/127 (15%)
Ig_MOG_like 42..141 CDD:143190 19/128 (15%)
IGc domain 142..228 13/93 (14%)
transmembrane domain 1 247..269 1/14 (7%)
transmembrane domain 2 282..304
transmembrane domain 3 326..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.