| Sequence 1: | NP_611728.1 | Gene: | CG13532 / 37632 | FlyBaseID: | FBgn0034788 | Length: | 263 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036011782.1 | Gene: | Icosl / 50723 | MGIID: | 1354701 | Length: | 347 | Species: | Mus musculus |
| Alignment Length: | 225 | Identity: | 42/225 - (18%) |
|---|---|---|---|
| Similarity: | 69/225 - (30%) | Gaps: | 82/225 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 EPDPLVLD-------------------CEVEIGPREQGFVLKWLFNNHSIYQWIPSVKGFAMG-- 87
Fly 88 --------FMKSKIDTKIFTMEGSPGVISIKNP---DWNMTGEYTCAVQTFESTDKRSARLQIIV 141
Fly 142 PESDFMLEARMSGSRMDVDIMCAVQHVFPQPMLSVMFDTHILDSVLTQLDQDPSGLYSMTVRTRI 206
Fly 207 PRDQLESPTPITC-AFILVGTNYTKRRETI 235 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13532 | NP_611728.1 | None | |||
| Icosl | XP_036011782.1 | IgV_B7-H2 | 123..236 | CDD:409529 | 30/145 (21%) |
| Ig strand B | 133..137 | CDD:409529 | 1/3 (33%) | ||
| Ig strand C | 151..155 | CDD:409529 | 1/17 (6%) | ||
| Ig strand E | 196..200 | CDD:409529 | 1/3 (33%) | ||
| Ig strand F | 210..215 | CDD:409529 | 3/8 (38%) | ||
| Ig strand G | 228..231 | CDD:409529 | 1/3 (33%) | ||
| Ig | 241..328 | CDD:416386 | |||
| Ig strand B | 256..263 | CDD:409353 | |||
| Ig strand C | 269..276 | CDD:409353 | |||
| Ig strand C' | 280..281 | CDD:409353 | |||
| Ig strand D | 289..292 | CDD:409353 | |||
| Ig strand E | 299..307 | CDD:409353 | |||
| Ig strand F | 314..321 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1537230at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||