DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and Icosl

DIOPT Version :10

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_036011782.1 Gene:Icosl / 50723 MGIID:1354701 Length:347 Species:Mus musculus


Alignment Length:225 Identity:42/225 - (18%)
Similarity:69/225 - (30%) Gaps:82/225 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EPDPLVLD-------------------CEVEIGPREQGFVLKWLFNNHSIYQWIPSVKGFAMG-- 87
            ||.||.|.                   |.|.:|.|:            .:::.:....||..|  
Mouse    55 EPQPLQLSASEIQHPAVCARTMQLKCPCFVSLGTRQ------------PVWKKLHVSSGFFSGLG 107

  Fly    88 --------FMKSKIDTKIFTMEGSPGVISIKNP---DWNMTGEYTCAVQTFESTDKRSARLQIIV 141
                    ...:..:|::..|.||..|:|..:|   .:|::|.|              ...||..
Mouse   108 LFLLLLSSLCAASAETEVGAMVGSNVVLSCIDPHRRHFNLSGLY--------------VYWQIEN 158

  Fly   142 PESDFMLEARMSGSRMDVDIMCAVQHVFPQPMLSVMFDTHILDSVLTQLDQDPSGLYSMTVRTRI 206
            ||                   .:|.:..|.....:..|:...:.....||....|.:|:.::...
Mouse   159 PE-------------------VSVTYYLPYKSPGINVDSSYKNRGHLSLDSMKQGNFSLYLKNVT 204

  Fly   207 PRDQLESPTPITC-AFILVGTNYTKRRETI 235
            |:|..|    .|| .|:...|...|..|.:
Mouse   205 PQDTQE----FTCRVFMNTATELVKILEEV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
IcoslXP_036011782.1 IgV_B7-H2 123..236 CDD:409529 30/145 (21%)
FR1 123..142 CDD:409529 7/18 (39%)
Ig strand A 123..128 CDD:409529 1/4 (25%)
Ig strand B 131..137 CDD:409529 2/5 (40%)
CDR1 143..149 CDD:409529 1/5 (20%)
FR2 150..156 CDD:409529 1/19 (5%)
Ig strand C 150..156 CDD:409529 1/19 (5%)
CDR2 157..177 CDD:409529 4/38 (11%)
Ig strand C' 161..166 CDD:409529 1/4 (25%)
Ig strand C' 169..171 CDD:409529 0/1 (0%)
FR3 178..217 CDD:409529 9/42 (21%)
Ig strand D 183..187 CDD:409529 0/3 (0%)
Ig strand E 196..202 CDD:409529 1/5 (20%)
Ig strand F 209..217 CDD:409529 3/11 (27%)
CDR3 218..221 CDD:409529 0/2 (0%)
FR4 222..236 CDD:409529 2/9 (22%)
Ig strand G 223..236 CDD:409529 2/8 (25%)
Ig 241..328 CDD:472250
Ig strand B 256..260 CDD:409353
Ig strand C 270..276 CDD:409353
Ig strand E 303..307 CDD:409353
Ig strand F 314..319 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.