DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and Icoslg

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006256322.1 Gene:Icoslg / 499415 RGDID:1562791 Length:315 Species:Rattus norvegicus


Alignment Length:224 Identity:49/224 - (21%)
Similarity:82/224 - (36%) Gaps:42/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DCEVE-IGPREQGFVLKWLFNNHSIY-QWIPSVKGFAMGFMKSKIDTKIFTMEGSPGVISIKNPD 113
            |.|:. :.||...|.|..|:    :| |.:...|.....::.|..::....:..|....:..:||
  Rat    36 DVELRCVYPRRSHFSLDDLY----VYWQIVDEAKTVVTYYLPSANESSTIHVSNSYKNRAHLSPD 96

  Fly   114 WNMTGEYTCAVQTFESTDKRSARLQIIVPE--SDF-MLEARMS---GSRMDVDIMCAVQHVFPQP 172
            ....|::             |..||.:.|:  .:| .|..|||   |..::..:...|...|..|
  Rat    97 LMKEGDF-------------SLHLQNVTPQDTQEFKCLVFRMSTVLGKALEEVVRLRVAANFSTP 148

  Fly   173 MLSVMFDTHILDSVLTQLDQDPSGLYSMTVRTR--IPRDQLE--SPTPITCAFILVGTNYTKRRE 233
            ::|            |....||....:.|..::  .|...|.  :.|..|.....:..|.....|
  Rat   149 VIS------------TSGSSDPGQERTFTCMSKNGYPEPNLYWINRTDNTLIDETLQNNTVYLNE 201

  Fly   234 TIFYDKASTIQRKWTT-VAVVMSIASLAL 261
            ...||..||::..||. |.|:..:.::||
  Rat   202 LGLYDVVSTLRIPWTPHVDVICCVENVAL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
IcoslgXP_006256322.1 V-set 27..141 CDD:284989 25/121 (21%)
Ig 147..234 CDD:299845 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.