DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and beat-VI

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster


Alignment Length:271 Identity:50/271 - (18%)
Similarity:100/271 - (36%) Gaps:61/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LRATLLAVLALLSVTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQG--FVLKWLFNN 71
            |..:.:.:..||...|.::...:.||....:     .:...|.|:.::   ||.  :.::|.|..
  Fly    35 LALSWIIISELLLSAHCLKDLKIFVPEAVLM-----GNAATLSCQYDL---EQAALYAVRWYFGQ 91

  Fly    72 HSIYQWIPSVKGFAMGFMKSKIDTKIFTMEGSPGVISIKNPDWNMTGEYTCAVQ---TFESTDKR 133
            ...|:::|........|..:.|:..:...:.:.  :::|.....::|.|.|.|.   ....|:.|
  Fly    92 EEFYRYVPREAKPTFVFAVAGINVDLANSDATS--VTLKGVTRELSGSYQCEVSEDAPLFHTEIR 154

  Fly   134 SARLQII-VPESD--FMLEARMSGSRMDVDIMCAVQHVFP---------------QPMLSVMFDT 180
            ||.:|:| :|:.|  ..::.::.|...:...:|.|...:|               .|:..:..||
  Fly   155 SAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRISQDT 219

  Fly   181 HILDSVLTQLDQDPSG-------------------------LYSMTVRTRIPRDQLESPTPITCA 220
            :...:..:.||..|:.                         :|...|..||   .|.:..|.|.:
  Fly   220 YEGSTTYSSLDIYPNSQALQGFFETKYQHSVNLQCVVTIRHMYHKVVAQRI---GLNAAPPTTIS 281

  Fly   221 FILVGTNYTKR 231
            ..|:|...:||
  Fly   282 PNLLGLEGSKR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
beat-VINP_001263035.1 Ig 66..142 CDD:416386 14/80 (18%)
Ig strand B 67..76 CDD:409353 2/8 (25%)
CDR1 76..83 CDD:409353 2/9 (22%)
Ig strand C 83..91 CDD:409353 2/7 (29%)
FR2 84..91 CDD:409353 2/6 (33%)
CDR2 94..108 CDD:409353 2/13 (15%)
Ig strand C' 94..99 CDD:409353 1/4 (25%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 5/35 (14%)
Ig strand D 117..121 CDD:409353 0/3 (0%)
Ig strand E 123..127 CDD:409353 0/5 (0%)
Ig strand F 136..144 CDD:409353 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.