DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and beat-IV

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster


Alignment Length:143 Identity:31/143 - (21%)
Similarity:54/143 - (37%) Gaps:35/143 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TH--SVRITNLR---VPRTY------------TLFRDHEPDPLVLDCEVEIGPREQG---FVLKW 67
            ||  ||.::|..   ||..|            :..|:.|.|      |.|....|:|   :.:||
  Fly   158 THSGSVSVSNGNSNGVPAAYMPDFDRADSFDDSHDREEEED------EDEEEQPEEGEALYAIKW 216

  Fly    68 LFNNHSIYQWIPSVKGFAMGFMKSKID-TKIFTMEGSPGVISIKNPDWNMTGEYTCAVQ----TF 127
            ..:|...|:::|..:.....:   ::| .::.........:.::....|.||.|.|.|.    .|
  Fly   217 YKDNEEFYRYVPKARPPKTSY---RVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEVSAEAPNF 278

  Fly   128 ESTDKRSARLQII 140
            .|. :...|:.|:
  Fly   279 SSV-QGEGRMDIV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 14/76 (18%)
Ig 314..>362 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.