powered by:
Protein Alignment CG13532 and beat-IIb
DIOPT Version :9
Sequence 1: | NP_611728.1 |
Gene: | CG13532 / 37632 |
FlyBaseID: | FBgn0034788 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650613.2 |
Gene: | beat-IIb / 42082 |
FlyBaseID: | FBgn0038494 |
Length: | 407 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 16/64 - (25%) |
Similarity: | 30/64 - (46%) |
Gaps: | 18/64 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 TKIFTMEGSPGV-----------ISIKNPDWNMTGEYTCAVQT---FESTDKRSARLQII-VPE 143
||:|.. ||: :.|:|..:.::|:::|.|.. ..||....|::|:: .||
Fly 150 TKVFQF---PGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAFAQMQVVEFPE 210
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13532 | NP_611728.1 |
None |
beat-IIb | NP_650613.2 |
IG_like |
108..198 |
CDD:214653 |
12/50 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45451063 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21261 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.