DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and beat-Vb

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:79/207 - (38%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GRGLRATLLAVLALLSVTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFN 70
            ||.|....:.:|.::.....:|:|::.||:... |||:    :.|.|..:|.......| ||..|
  Fly     4 GRWLLQLGVHMLLVVRRIQCLRVTDINVPQIVD-FRDN----VTLSCSYDISGHTLNSV-KWYKN 62

  Fly    71 NHSIYQWIPSVKGFAMGFMKSKIDTKI-FTMEGSPGVISIKNPDWNMTGEYTCAVQTFESTDKRS 134
            ....:::.|...           .|.| |.:||...:     .|.|...|.:|.|:......|.|
  Fly    63 GKEFFRYSPLTP-----------PTYIPFAVEGVQLI-----DDGNECNESSCRVELNLLGVKSS 111

  Fly   135 A--RLQIIVPESDFMLEARMSGSRMDVDIMCAVQHVFPQ--PMLSVMFDTH-ILDSVLTQLDQDP 194
            .  |.::......|.|.||  .:.|.|:.:       ||  |::|....|: ..|.|......|.
  Fly   112 GVYRCEVSGDAPHFQLTAR--DANMTVEAL-------PQNNPLISSFHSTYRFNDFVEVNCSTDF 167

  Fly   195 SGLYSMTVRTRI 206
            |.|:     |||
  Fly   168 SSLF-----TRI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 22/102 (22%)
Ig 41..130 CDD:143165 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.