DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and CG5597

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:175 Identity:45/175 - (25%)
Similarity:84/175 - (48%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLAVLALLSVTHSVRI---TNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFNNHS 73
            |||..:..:.:.|...:   |.........:.::.|.:|.:|||:.|:....:...:||..::.|
  Fly     3 TLLIAILAIGLLHRDALCYPTRDESEDKIIVLQNEEMEPTILDCDYEVEESPKFITVKWYRDDKS 67

  Fly    74 IYQWIPSVKGFAMGFMKSKIDTKIFTMEGSP------GVISIKNPDWNMTGEYTCAVQTFESTDK 132
            |||||.....:|:...:::||:   |.|.|.      ..:::.||....||:|.|.|||..:|..
  Fly    68 IYQWIFGTPPYAIPEFRNEIDS---TYESSTEPSKQYSSLALINPTIATTGDYKCVVQTSLNTFS 129

  Fly   133 RSARLQIIVPESDFMLEARMSGSRMDVDIMCAVQHVFPQPMLSVM 177
            ...|:|:| ...::.||........:..:.|.|.:|:|:|.::::
  Fly   130 SHQRVQVI-DLRNYTLELSHKTIHNETQLNCTVTNVYPRPTITII 173



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BNCC
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109340at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7639
65.850

Return to query results.
Submit another query.