DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and beat-IIIc

DIOPT Version :10

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster


Alignment Length:154 Identity:28/154 - (18%)
Similarity:66/154 - (42%) Gaps:20/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLAVLALLSV-----THSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFNN 71
            :|||.|..:..     ...:|:|.:|:| .|.:    :.....|:|..:: ..|..:.:||..:.
  Fly     6 SLLAALFFIGTLKDFRVAGLRLTEVRIP-MYVI----KGTAAQLECLYDL-DGEALYSVKWYKDG 64

  Fly    72 HSIYQWIPSVKGFAMGFMKSKIDTKIFTMEGSPGVISIKNPDWNMTGEYTCAVQ----TFESTDK 132
            :..|:::|.....|..|:...::..:.  ..|..:::::|.:....|.:.|.|.    :|::..:
  Fly    65 NEFYRYVPRDMPPAQTFLLPGVNVDLH--NSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTE 127

  Fly   133 RSARLQIIVPESDFMLEARMSGSR 156
            ....:...:|:..   ..::||.|
  Fly   128 HGDMIVAYLPDEG---SPKISGGR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 17/101 (17%)
Ig strand B 42..46 CDD:409353 1/3 (33%)
Ig strand C 57..61 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 0/3 (0%)
Ig strand F 110..115 CDD:409353 1/4 (25%)
Ig 140..>194 CDD:472250 3/12 (25%)
Ig strand B 157..161 CDD:409353
Ig strand C 171..174 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.