DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and beat-IIIb

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster


Alignment Length:135 Identity:26/135 - (19%)
Similarity:56/135 - (41%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAVLALLSVTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFNNHSIYQW 77
            ||..|...|| ..:.:|.:::|:......|     .||.|:.:: ..|..:.:||..:....|::
  Fly    19 LLLQLCFESV-ECLTMTEIKIPKHIMRHED-----AVLGCKFDL-DGESLYSVKWYKDGFEFYRY 76

  Fly    78 IPSVKGFAMGFMKSKIDTKIFTMEGSPGVISIKNPDWNMTGEYTCAVQ----TFESTDKRSARLQ 138
            :|........|....:|.::  ...:..|:.:::.....||.|.|.|.    :|::.......:.
  Fly    77 VPRDMPPGQVFPLPGVDVEL--QNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHEDMIV 139

  Fly   139 IIVPE 143
            ::.|:
  Fly   140 VVTPK 144



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.