Sequence 1: | NP_611728.1 | Gene: | CG13532 / 37632 | FlyBaseID: | FBgn0034788 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848901.2 | Gene: | Skint4 / 320640 | MGIID: | 2444425 | Length: | 482 | Species: | Mus musculus |
Alignment Length: | 322 | Identity: | 60/322 - (18%) |
---|---|---|---|
Similarity: | 108/322 - (33%) | Gaps: | 98/322 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LLAVLALLSVTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFNNHS---- 73
Fly 74 IYQWIPSVKGFAMGFMKSKIDTKIFTMEGSPG--VISIKNPDWNMTGEYTCAVQTFESTDKRSAR 136
Fly 137 LQIIVPESDF------------MLEARMSGSRMDVDIMCAVQHVFPQPMLSVMFDT-HILDSVLT 188
Fly 189 QLDQDPSGLYSMTVRTRIPRDQLESPTPITCAF-------------ILVG--------------- 225
Fly 226 ---------TNYTKRRETIFYDKASTIQR-----------------KWTTVAVVMSIASLAL 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13532 | NP_611728.1 | None | |||
Skint4 | NP_848901.2 | IG_like | 41..147 | CDD:214653 | 23/113 (20%) |
Ig_MOG_like | 49..148 | CDD:143190 | 19/105 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |