DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and Skint4

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_848901.2 Gene:Skint4 / 320640 MGIID:2444425 Length:482 Species:Mus musculus


Alignment Length:322 Identity:60/322 - (18%)
Similarity:108/322 - (33%) Gaps:98/322 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAVLALLSVTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFNNHS---- 73
            ||.::| ||..|...|.:.| |...||..:.|     |:|::....:.|...::|..|.::    
Mouse    24 LLQMVA-LSSGHFTVIGSQR-PILATLGGNVE-----LNCQLSPPQQAQHMEIRWFRNRYTQPVH 81

  Fly    74 IYQWIPSVKGFAMGFMKSKIDTKIFTMEGSPG--VISIKNPDWNMTGEYTCAVQTFESTDKRSAR 136
            :|:...::.|..|.  |....|::.|...:.|  ::.|.|...:..|.|.|..:..|..::....
Mouse    82 LYRNGKNLHGETMS--KYVERTELLTDAFNEGKVILRILNVTVDDGGAYHCVFKDGEFYEEHITE 144

  Fly   137 LQIIVPESDF------------MLEARMSGSRMDVDIMCAVQHVFPQPMLSVMFDT-HILDSVLT 188
            :::....||.            |||....|             .||||.:...... .::.:...
Mouse   145 VKVTATSSDIQILMHTPNIKGVMLECHSGG-------------WFPQPHMEWRNSKGEVIQATSK 196

  Fly   189 QLDQDPSGLYSMTVRTRIPRDQLESPTPITCAF-------------ILVG--------------- 225
            ...||.:.|::|::...|   :..|...:.|.|             :|.|               
Mouse   197 FHSQDKNKLFNMSMVLFI---EASSHRNVICYFQNLVTHQEQSINIVLSGELFSWKIVWIMILST 258

  Fly   226 ---------TNYTKRRETIFYDKASTIQR-----------------KWTTVAVVMSIASLAL 261
                     ..|..:::.|..:..||:..                 .|..:|||..|:..|:
Mouse   259 ISFVMIDFCMTYCVQQQLIHEESLSTVDNDQCESDQSEGTCYKRNYPWIIIAVVPIISVFAI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
Skint4NP_848901.2 IG_like 41..147 CDD:214653 23/113 (20%)
Ig_MOG_like 49..148 CDD:143190 19/105 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.