DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and CD274

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_054862.1 Gene:CD274 / 29126 HGNCID:17635 Length:290 Species:Homo sapiens


Alignment Length:167 Identity:28/167 - (16%)
Similarity:56/167 - (33%) Gaps:55/167 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DHEPDPLVLDCEVEIGPREQGFVLKWLFNNHSIYQWIPSVKGFAMGFMKSKIDTKIFTMEGSPGV 106
            :||     |.|:.|..|:.:   :.|..::|.:.....:.       ..||.:.|:|.:..:..:
Human   150 EHE-----LTCQAEGYPKAE---VIWTSSDHQVLSGKTTT-------TNSKREEKLFNVTSTLRI 199

  Fly   107 ISIKNPDWNMTGEYTCAVQTFESTDKRSARLQIIVPE--------------------------SD 145
            .:..|.      .:.|..:..:..:..:|  ::::||                          ..
Human   200 NTTTNE------IFYCTFRRLDPEENHTA--ELVIPELPLAHPPNERTHLVILGAILLCLGVALT 256

  Fly   146 FMLEARMSGSRMDVDIMCAVQHVFPQPMLSVMFDTHI 182
            |:...| .|..|||. .|.:|....:.    ..|||:
Human   257 FIFRLR-KGRMMDVK-KCGIQDTNSKK----QSDTHL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
CD274NP_054862.1 Ig 54..117 CDD:325142
Ig 135..220 CDD:325142 14/90 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.