Sequence 1: | NP_611728.1 | Gene: | CG13532 / 37632 | FlyBaseID: | FBgn0034788 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350343.1 | Gene: | Btnl10 / 192194 | MGIID: | 2182073 | Length: | 492 | Species: | Mus musculus |
Alignment Length: | 244 | Identity: | 43/244 - (17%) |
---|---|---|---|
Similarity: | 71/244 - (29%) | Gaps: | 76/244 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 PDPLV--------LDCEVEIGPREQGFVLKWLFNNHS----IYQWIPSVKGFAMGFMKSKIDTKI 97
Fly 98 FTMEGSPGVISIKNPDWNMTGEYTCAVQTFESTDKRSARLQIIVPESDFMLEARMSGSRMDVD-- 160
Fly 161 ------IMCAVQHVFPQPMLS--------VMFDTHI----------LDSVLTQLDQDPSGL---- 197
Fly 198 ------------YSMTVRTRIPRDQLESP-------------TPITCAF 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13532 | NP_611728.1 | None | |||
Btnl10 | NP_001350343.1 | Ig_MOG_like | 47..146 | CDD:319291 | 17/107 (16%) |
Ig | 151..229 | CDD:386229 | 13/77 (17%) | ||
SPRY | 301..471 | CDD:383051 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |