DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and Btnl10

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001350343.1 Gene:Btnl10 / 192194 MGIID:2182073 Length:492 Species:Mus musculus


Alignment Length:244 Identity:43/244 - (17%)
Similarity:71/244 - (29%) Gaps:76/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PDPLV--------LDCEVEIGPREQGFVLKWLFNNHS----IYQWIPSVKGFAMGFMKSKIDTKI 97
            |.||:        |.|::.:....:|..|:|..:..|    :|:....|....|...|.:.....
Mouse    39 PHPLLAIVGQDKELPCKLSLNISAEGMELRWYRDKPSSVVHVYKNGEDVYDEQMVEYKGRTSFNG 103

  Fly    98 FTMEGSPGVISIKNPDWNMTGEYTCAVQTFESTDKRSARLQIIVPESDFMLEARMSGSRMDVD-- 160
            ..:......:.|.|......|.|.|..:.:.|..:.:..|::         ..|.|..|:.|.  
Mouse   104 SHVARGEAAVKIHNVTVFDNGTYHCVFKEYTSHSQATLWLKV---------AGRGSSPRIRVTDT 159

  Fly   161 ------IMCAVQHVFPQPMLS--------VMFDTHI----------LDSVLTQLDQDPSGL---- 197
                  ..|.....:|:|.:.        |..::|.          |.|::|..|....||    
Mouse   160 QDKGIRAECTSAGWYPEPKVEWLDLKGQPVSAESHFSVSASTGLVALLSIVTPQDTAVGGLTCSI 224

  Fly   198 ------------YSMTVRTRIPRDQLESP-------------TPITCAF 221
                        |.:...:|.|......|             ..|.|||
Mouse   225 SNPLLPEKVTETYLLASLSRRPLSTESGPALPLILTALGLVSAAIACAF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
Btnl10NP_001350343.1 Ig_MOG_like 47..146 CDD:319291 17/107 (16%)
Ig 151..229 CDD:386229 13/77 (17%)
SPRY 301..471 CDD:383051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.