DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and LOC102723996

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006723962.1 Gene:LOC102723996 / 102723996 -ID:- Length:516 Species:Homo sapiens


Alignment Length:140 Identity:34/140 - (24%)
Similarity:60/140 - (42%) Gaps:33/140 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 MLEARMSGSRMDVDIMCAVQHVFPQPMLSVMF----DTHILDSVLTQLDQ---DPSGLYSMTVRT 204
            ::.|..|.|:.::...|...:.:|:|  :|.:    |..:||..| |.|.   :..|||.:....
Human   142 VVSAPHSPSQDELTFTCTSINGYPRP--NVYWINKTDNSLLDQAL-QNDTVFLNMRGLYDVVSVL 203

  Fly   205 RIPRDQLESPTP---ITCAF--ILVGTNYT---------KRRETIFYDKASTIQRK---WTTVAV 252
            ||.|      ||   |.|..  :|:..|.|         ..|:.|..:..||.::.   |:.:||
Human   204 RIAR------TPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAV 262

  Fly   253 VMSIASLALS 262
            :..:..:|::
Human   263 LCLLVVVAVA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
LOC102723996XP_006723962.1 V-set 20..131 CDD:284989
Ig 153..225 CDD:299845 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.