DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13532 and icoslg

DIOPT Version :9

Sequence 1:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031752273.1 Gene:icoslg / 101732704 -ID:- Length:298 Species:Xenopus tropicalis


Alignment Length:52 Identity:12/52 - (23%)
Similarity:22/52 - (42%) Gaps:11/52 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WIPSVKGFAMGFMKSKID--------TKIFTMEGSPGV---ISIKNPDWNMT 117
            |..||.|..:|..:...:        |.|.|:..:..:   .:::||..|:|
 Frog   171 WRNSVDGSLLGSGRLNTEKHKDYVNVTSIVTVNVTQSLNITCTVENPQGNVT 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13532NP_611728.1 None
icoslgXP_031752273.1 Ig 29..135 CDD:416386
Ig strand B 31..37 CDD:409353
CDR1 43..48 CDD:409353
FR2 49..55 CDD:409353
Ig strand C 49..55 CDD:409353
FR3 70..118 CDD:409353
Ig strand D 84..88 CDD:409353
Ig strand E 97..103 CDD:409353
Ig strand F 110..118 CDD:409353
CDR3 119..121 CDD:409353
FR4 122..135 CDD:409353
Ig strand G 123..135 CDD:409353
IG_like 151..223 CDD:214653 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.