powered by:
Protein Alignment CG13532 and icoslg
DIOPT Version :9
Sequence 1: | NP_611728.1 |
Gene: | CG13532 / 37632 |
FlyBaseID: | FBgn0034788 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031752273.1 |
Gene: | icoslg / 101732704 |
-ID: | - |
Length: | 298 |
Species: | Xenopus tropicalis |
Alignment Length: | 52 |
Identity: | 12/52 - (23%) |
Similarity: | 22/52 - (42%) |
Gaps: | 11/52 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 WIPSVKGFAMGFMKSKID--------TKIFTMEGSPGV---ISIKNPDWNMT 117
|..||.|..:|..:...: |.|.|:..:..: .:::||..|:|
Frog 171 WRNSVDGSLLGSGRLNTEKHKDYVNVTSIVTVNVTQSLNITCTVENPQGNVT 222
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1537230at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.