DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXQ1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_150285.3 Gene:FOXQ1 / 94234 HGNCID:20951 Length:403 Species:Homo sapiens


Alignment Length:258 Identity:92/258 - (35%)
Similarity:124/258 - (48%) Gaps:48/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGA---------------- 68
            ||  |:.|..|:|:...|:|:|..|...|..   ...|.|.|:.||.||                
Human    31 PL--SAAGDDSLGSDGDCAANSPAAGGGARD---TQGDGEQSAGGGPGAEEAIPAAAAAAVVAEG 90

  Fly    69 ---------AGGNGDGSGSSGGPLV---KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPY 121
                     |||.|.|.|:...|..   ||||||||||.|||..|...:|||:.|.:::|.:||:
Human    91 AEAGAAGPGAGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPF 155

  Fly   122 YKDKFPAWQNSIRHNLSLNDCFIKVPREPGNP-GKGNFWTLDPLAEDMFDNGSFLRRRKRYKR-- 183
            ::..:..|:||:||||||||||:||.|:|..| ||.|:|.|:|.:|..|.:|.|.|||||...  
Human   156 FRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRA 220

  Fly   184 ---APTMQRFSFPAVFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRAD 243
               ||.::....|.:  ..:|    .|.|..|..   |........:...:||..|.|:...|
Human   221 PVPAPGLRPEEAPGL--PAAP----PPAPAAPAS---PRMRSPARQEERASPAGKFSSSFAID 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 47/86 (55%)
FOXQ1NP_150285.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 17/48 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 7/21 (33%)
FH 119..197 CDD:238016 43/77 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..266 10/58 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.