DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxk2b

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_001922856.1 Gene:foxk2b / 798356 ZFINID:ZDB-GENE-030131-5310 Length:597 Species:Danio rerio


Alignment Length:216 Identity:77/216 - (35%)
Similarity:101/216 - (46%) Gaps:24/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DSVS--LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIE---PSSMGGSGAAGGN 72
            |:::  :||  :.|..|..|..|  .|.:|.|.|.:....:|....|::   .:|...:......
Zfish   142 DNIAHLMSP--LPSPTGTISAAN--SCPSSPRGAGSSGYRLGRIVPDLQLMNDNSQSENDKETSE 202

  Fly    73 GDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNL 137
            ||......    ||||||..||..||..:|.|:|||:||...|...:|||:.....|||||||||
Zfish   203 GDSPKDDS----KPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNL 263

  Fly   138 SLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPF 202
            |||..||||||....||||:||.:||.:|......:|.:||.|          ..|.....|.|.
Zfish   264 SLNRYFIKVPRSQEEPGKGSFWRIDPSSEGKLVEQAFRKRRPR----------GVPCFRTPLGPL 318

  Fly   203 WIRKPVPLVPVHFNVPNFNGS 223
            ..|. .|..|.|..|.:.:.|
Zfish   319 SSRS-APASPNHSGVLSAHSS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/85 (56%)
foxk2bXP_001922856.1 FHA 17..109 CDD:238017
Forkhead 211..297 CDD:278670 48/85 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.