DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxj3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001313317.1 Gene:foxj3 / 797147 ZFINID:ZDB-GENE-101005-1 Length:596 Species:Danio rerio


Alignment Length:129 Identity:57/129 - (44%)
Similarity:75/129 - (58%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            ||||||.:|||.||..||.||:|||.|..:|...||||::....|:||||||||||.||:||||.
Zfish    62 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRS 126

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFP------------AVFGTLSP 201
            ..:||||::|.:|...::     ..|..|.: ||..:.:|.|.|            .:.|:.||
Zfish   127 KDDPGKGSYWAIDTNPKE-----DTLPTRPK-KRPRSGERASTPYSLESDNLGMDCIISGSASP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 47/85 (55%)
foxj3NP_001313317.1 Forkhead 62..139 CDD:278670 46/76 (61%)
SelP_N <327..394 CDD:282453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.