Sequence 1: | NP_523814.1 | Gene: | fd59A / 37631 | FlyBaseID: | FBgn0004896 | Length: | 456 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070174.2 | Gene: | foxj1a / 767737 | ZFINID: | ZDB-GENE-060929-1178 | Length: | 458 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 76/206 - (36%) |
---|---|---|---|
Similarity: | 101/206 - (49%) | Gaps: | 29/206 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MHTSTDPM--HTLHDSVSLSPPL-----------IKSSRG----GSSIGNGIGCSASSRTAAADA 48
Fly 49 MSMGCDDSDIEP-----------SSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSP 102
Fly 103 HKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAED 167
Fly 168 MFDNGSFLRRR 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd59A | NP_523814.1 | Forkhead | 85..171 | CDD:278670 | 47/85 (55%) |
foxj1a | NP_001070174.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..99 | 9/30 (30%) | |
Forkhead | 142..228 | CDD:278670 | 47/85 (55%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..324 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.950 |