DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxj1a

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001070174.2 Gene:foxj1a / 767737 ZFINID:ZDB-GENE-060929-1178 Length:458 Species:Danio rerio


Alignment Length:206 Identity:76/206 - (36%)
Similarity:101/206 - (49%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTSTDPM--HTLHDSVSLSPPL-----------IKSSRG----GSSIGNGIGCSASSRTAAADA 48
            :.||| |:  :|..||.:|...|           :.:|.|    .||..:.:|..|.|...|.|.
Zfish    31 LDTST-PLQCNTSLDSDNLDDSLTSLQWLQEFSILNASTGQHTSPSSHSHLMGSDAPSSPLAGDP 94

  Fly    49 MSMGCDDSDIEP-----------SSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSP 102
            .|:|...:..:|           |::....|.|...|.......|.:||||||..||.||:..|.
Zfish    95 ASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASK 159

  Fly   103 HKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAED 167
            ..|:|||.|..:|...|.|::...|.||||||||||||.|||||||:...||||.||.:||...:
Zfish   160 KTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAE 224

  Fly   168 MFDNGSFLRRR 178
            ...|.::.:||
Zfish   225 RLLNEAYKKRR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 47/85 (55%)
foxj1aNP_001070174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..99 9/30 (30%)
Forkhead 142..228 CDD:278670 47/85 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.