DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxb2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001162056.1 Gene:Foxb2 / 691398 RGDID:1585019 Length:425 Species:Rattus norvegicus


Alignment Length:304 Identity:99/304 - (32%)
Similarity:132/304 - (43%) Gaps:83/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            |||||||:|..|||..|..|.|.||.|..|||.|||||::....||||:|||||.||||||:||.
  Rat    13 KPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK--RA--PTMQRFSFPAVFGT------------ 198
            |..||||:||.|.|...|||:||||||||||:|  ||  ..:...|.....||            
  Rat    78 PDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHAHLHSGSSKGAPGTGPGGHLHPHHPH 142

  Fly   199 ------------------------------LSPFWIRKPVPLVPVHFNVPNFNGSR-----EFDV 228
                                          :.|::.::|.| .|...::|:....:     :...
  Rat   143 HAHHHHHHHHHAAHHHHHHHPPQPPPPPPHMVPYFHQQPAP-APQPPHLPSQPAQQPPPQSQPPQ 206

  Fly   229 VHNPADVFDSALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGG 293
            ..:|..:.::|..|       |.|.|:......|..:..:.|              |:..||...
  Rat   207 TSHPGKMQEAAAVA-------AAAAAAAAAAVGSVGRLSQFP--------------PYGLGSAAA 250

  Fly   294 VGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRDYAERLSAGG 337
            ....:.:|. :.:|.|:|.:        .|.| |||...|.|||
  Rat   251 AAAAAAAST-TGFKHPFAIE--------NIIG-RDYKGVLQAGG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 54/85 (64%)
Foxb2NP_001162056.1 FH 13..101 CDD:214627 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.