DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxk2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_011247520.1 Gene:Foxk2 / 68837 MGIID:1916087 Length:690 Species:Mus musculus


Alignment Length:217 Identity:79/217 - (36%)
Similarity:103/217 - (47%) Gaps:27/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGG 71
            |:.:...::|.:.....|.||..|.|..:|     |...:| :|:..|:|..|    ....|:||
Mouse   226 PLPSPTGTISAANSCPSSPRGAGSSGYKVG-----RVMPSD-LSLMADNSQPE----NEKEASGG 280

  Fly    72 NGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHN 136
            :.....|      ||||||..||..||..:|.|:|||:||...|...:|||:.....||||||||
Mouse   281 DSPKDDS------KPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHN 339

  Fly   137 LSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSP 201
            ||||..||||||....||||:||.:||.:|......:|.:||.|          ..|.....|.|
Mouse   340 LSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPR----------GVPCFRTPLGP 394

  Fly   202 FWIRKPVPLVPVHFNVPNFNGS 223
            ...|. .|..|.|..|.:.:.|
Mouse   395 LSSRS-APASPNHAGVLSAHSS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/85 (56%)
Foxk2XP_011247520.1 FHA 41..>124 CDD:238017
COG5025 <175..>381 CDD:227358 67/170 (39%)
Forkhead 287..373 CDD:365978 49/91 (54%)
PHA03247 <380..683 CDD:223021 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.