DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxl1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:294 Identity:95/294 - (32%)
Similarity:127/294 - (43%) Gaps:90/294 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKV 146
            |..||||||||||.|||..:|.:::||:||..|||.|||:|.|....||||||||||||:||:||
  Rat    46 PPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKV 110

  Fly   147 PREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRA------------------------PTM 187
            |||.|.||||::|||||...|||:||::.||:::.|.|                        |.:
  Rat   111 PREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEAKRTRVEPRESEVGCDVGSPNL 175

  Fly   188 ---------QRFSFPAVFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDV--------------- 228
                     .|...||..||.....:..|.|.:            |:.|.               
  Rat   176 ATARPMHEPDRSQSPAAGGTARSALLPWPGPEL------------RDPDADRTIQDAGAVASGQL 228

  Fly   229 ---VHNPADVFDSALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGS 290
               ||.|.....|:||...             .||..|.|       ::....|.:.|:.....|
  Rat   229 ERPVHYPVHHLGSSLRPAP-------------SGSPKGSK-------SKSFSIDSILAVRPKPAS 273

  Fly   291 GGGVGGGSESSRGSKYKSPYAFDVATVASAAGIP 324
            |....|.|:       ..|.|...:.:.:::|:|
  Rat   274 GAEAPGISK-------PLPGALGSSLLTASSGLP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 58/85 (68%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 59/87 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.