DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxj2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_068699.1 Gene:Foxj2 / 60611 MGIID:1926805 Length:565 Species:Mus musculus


Alignment Length:326 Identity:95/326 - (29%)
Similarity:129/326 - (39%) Gaps:112/326 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSTD--PMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGG 65
            ||.|  |..||..::.   .|..:|:.|.. |....||..|.|               :|::...
Mouse    10 TSIDWLPQLTLRATIE---KLGSASQAGPP-GGARKCSPGSPT---------------DPNATLS 55

  Fly    66 SGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQ 130
            ...|..:.||         ||.|||..|||.||..||.||:|||.|..:|...|||||:....|:
Mouse    56 KDEAAVHQDG---------KPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWK 111

  Fly   131 NSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAV 195
            ||||||||||.||.||||...:||||::||:|...:        :.|::|:.....:.:.| |..
Mouse   112 NSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD--------ISRKRRHPPDDDLSQDS-PEQ 167

  Fly   196 FGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVH---------NPADVFDSALRADKKFNFFAN 251
            ..:.||   |..||            ||.|..:.|         :|:.|                
Mouse   168 EASKSP---RGGVP------------GSGEASLSHEGTPQMSLQSPSSV---------------- 201

  Fly   252 AEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGS---ESSRGSK--YKSPYA 311
              |::.||..|.|                          ||.|..|:   ||:.|:.  |.:.:.
Mouse   202 --ANYSQGPGSVD--------------------------GGAVAAGAPGQESTEGAPPLYNTNHD 238

  Fly   312 F 312
            |
Mouse   239 F 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/85 (56%)
Foxj2NP_068699.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..61 9/47 (19%)
Forkhead 66..143 CDD:278670 47/76 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..233 38/175 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.