DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxf1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001073655.1 Gene:foxf1 / 566407 ZFINID:ZDB-GENE-050419-153 Length:380 Species:Danio rerio


Alignment Length:290 Identity:97/290 - (33%)
Similarity:132/290 - (45%) Gaps:98/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            ||||||||||.|||..||.|:||||.|..|:.||||:::..:..|:||:|||||||:||||:|:.
Zfish    52 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKG 116

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPVH 214
            .|.||||::||:||.:|.||:.|||.||.:.::                      ||...|.|..
Zfish   117 LGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR----------------------RKCQALKPSM 159

  Fly   215 FNVPN---FNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGS-------------QSG 263
            :::.|   ||        |.|           :.:||         ||.             :||
Zfish   160 YSMMNGLGFN--------HIP-----------ESYNF---------QGGGGGLSCPPNSLSLESG 196

  Fly   264 DKFDRLPFMNRGRGADVLD-------ALPH-SSGSGGGVGGGSESSRGSKYKSPYAFDVATVASA 320
                 :..|| |..|..::       ::|| |:.||....|....|.|::|              
Zfish   197 -----IGMMN-GHLASNMEGMGLAGHSMPHLSTNSGHSYMGSCTGSSGTEY-------------- 241

  Fly   321 AGIPGHRDYAERLSAGGGYMDLN-VYNDDA 349
               |.|...|..|...||.||.: ||:..|
Zfish   242 ---PHHDSSASPLLTSGGVMDPHAVYSSTA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
foxf1NP_001073655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
FH 52..140 CDD:214627 53/87 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.