DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxo6a

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_690041.2 Gene:foxo6a / 561541 ZFINID:ZDB-GENE-110914-126 Length:594 Species:Danio rerio


Alignment Length:187 Identity:63/187 - (33%)
Similarity:85/187 - (45%) Gaps:50/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IGCSASSRTAAADAMSMGCD---------------DSDIEPSSMGGSGA----AGGNGDGSGSSG 80
            :|.:|.|.:...|   ..||               |||..||.......    |||..|.:|:: 
Zfish    19 LGSAARSCSWTND---FSCDVVNADLSLNLSIFQVDSDRAPSPSCRRRMMVLDAGGFHDLTGAA- 79

  Fly    81 GPLVKPP----------YSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDK-----FPAWQ 130
              |.|..          .||..|||.||..:|.|:||||.|.|:::...||:|||     ...|:
Zfish    80 --LRKTKASSRRNAWGNQSYAELITRAIESTPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWK 142

  Fly   131 NSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTM 187
            |||||||||:..||:|..|  ..||.::|.|:|       .|..|.:.:| :||.:|
Zfish   143 NSIRHNLSLHTRFIRVQNE--GTGKSSWWMLNP-------EGGKLGKSQR-RRAVSM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 40/100 (40%)
foxo6aXP_690041.2 FH 92..172 CDD:238016 37/81 (46%)
PAT1 <390..>530 CDD:330585
FOXO-TAD 528..568 CDD:318811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.