DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxj2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_006237373.1 Gene:Foxj2 / 502886 RGDID:1565101 Length:623 Species:Rattus norvegicus


Alignment Length:319 Identity:96/319 - (30%)
Similarity:129/319 - (40%) Gaps:98/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSTD--PMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGG 65
            ||.|  |..||..::.   .|..:|:.|.. |....||..|.|               :|::...
  Rat    50 TSIDWLPQLTLRATIE---KLGSASQAGPP-GGTRKCSPGSPT---------------DPNATLS 95

  Fly    66 SGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQ 130
            ...|..:.||         ||.|||..|||.||..||.||:|||.|..:|...|||||:....|:
  Rat    96 KDEASVHQDG---------KPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWK 151

  Fly   131 NSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAV 195
            ||||||||||.||.||||...:||||::||:|...:        :.|::|:.....:.:.| |..
  Rat   152 NSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD--------ISRKRRHPPDDDLSQDS-PEQ 207

  Fly   196 FGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVH--NPADVFDSALRADKKFNFFANAEASFYQ 258
            ..:.||   |..||            ||.|..:.|  ||.....|           .::.||:.|
  Rat   208 EASKSP---RGGVP------------GSGEASLSHEGNPQMSLQS-----------PSSMASYSQ 246

  Fly   259 GSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGS---ESSRGSK--YKSPYAF 312
            |....|                          ||.|..|:   ||:.|:.  |.:.:.|
  Rat   247 GPGPVD--------------------------GGAVAAGAPGQESTEGAPPLYNTNHDF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/85 (56%)
Foxj2XP_006237373.1 Forkhead 106..183 CDD:278670 47/76 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.