DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxi3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:340 Identity:119/340 - (35%)
Similarity:154/340 - (45%) Gaps:69/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDGSGSSGG 81
            |.||....:..|:..|      .:..:|||             |:|..||.|.|..|..|.:|..
  Rat    79 LQPPAAPGTFAGAQRG------FTQPSAAA-------------PASPAGSAAPGELGWLSMASRE 124

  Fly    82 PL---VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCF 143
            .|   |:|||||.|||.|||..:|.:|||||.|..|:...||:|:.....|||||||||||||||
  Rat   125 DLMKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCF 189

  Fly   144 IKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPA-------------V 195
            .||||:..:|||||:|||||..|.|||||:|  ||||.:||......:.|:             |
  Rat   190 KKVPRDEDDPGKGNYWTLDPNCEKMFDNGNF--RRKRRRRAEASSNLTVPSGTSKSDGQSSRLRV 252

  Fly   196 FGTL---SPFWIRKP--VPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEAS 255
            .|.|   ||..:.:|  .|..|        .|::  ....:|.   .|.|.:....|.|.::..:
  Rat   253 SGKLEGDSPSSMLRPSQSPEPP--------EGTK--STASSPG---ASTLTSTPCLNTFLSSFNT 304

  Fly   256 FYQGSQSGDKFDRLPFMNRGRGADVL--------DALPHSSGSG---GGVGGGSESSRGSKYKSP 309
            ....:.|......||...|..|...|        .::|.||...   ..|||||:.   |.|.||
  Rat   305 LSVNASSMSTQRTLPGSRRHPGGTQLPSSTTFPSTSIPDSSLDSVQLSTVGGGSQL---SSYYSP 366

  Fly   310 YAFDVATVASAAGIP 324
            ::......:|..|.|
  Rat   367 FSGGSGDQSSPFGSP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 54/85 (64%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.