DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxd3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001011383.1 Gene:foxd3 / 496851 XenbaseID:XB-GENE-487289 Length:369 Species:Xenopus tropicalis


Alignment Length:215 Identity:115/215 - (53%)
Similarity:134/215 - (62%) Gaps:34/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDGSGSSG---- 80
            ||.|.|..||..|:           |.:|..:|  ..:|..|..|.:..|.|.|:.....|    
 Frog    34 PLDKDSECGSPAGH-----------AEEADELG--GKEIARSPSGSANEAEGKGESQQQEGMQNK 85

  Fly    81 --GPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCF 143
              ..||||||||||||||||||||.|||||||||:||.:|||||::|||||||||||||||||||
 Frog    86 PKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCF 150

  Fly   144 IKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR----------APTMQRFSFPAVFGT 198
            :|:|||||||||||:|||||.:|||||||||||||||:||          |..||.|   ..:..
 Frog   151 VKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRQQPDSLREQTALMMQSF---GAYSL 212

  Fly   199 LSPFWIRKPVPLVPVHFNVP 218
            ..|:  .:|..|.|..:..|
 Frog   213 AGPY--GRPYGLHPAAYTHP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 74/85 (87%)
foxd3NP_001011383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 17/67 (25%)
Forkhead 92..177 CDD:365978 73/84 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 1 1.000 - - X1212
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.