DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxj1b

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001008648.1 Gene:foxj1b / 494105 ZFINID:ZDB-GENE-041212-76 Length:442 Species:Danio rerio


Alignment Length:383 Identity:105/383 - (27%)
Similarity:141/383 - (36%) Gaps:128/383 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GCSASSRTAAADAMSMGCDDSDIEPSSMGGSGA-------AGGNGDGSGSSGGPL-------VKP 86
            |..:.|...|.|..:.|...:...|::...|.|       ||....|..:....:       |||
Zfish    76 GTDSPSSPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGQYITGQTNPAEEIDYKTNRHVKP 140

  Fly    87 PYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPG 151
            ||||..||.||:..|...|:|||.|..:|...|.||:...|:||||||||||||.||:||||:..
Zfish   141 PYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKD 205

  Fly   152 NPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPVHFN 216
            .||||.||.:||...|||.||.|.|||             .||.                     
Zfish   206 EPGKGGFWQIDPQYADMFVNGVFKRRR-------------MPAT--------------------- 236

  Fly   217 VPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGS-------QSGDKFDRL---PF 271
              |||..|:..::.:|:..:.|..........|        ||:       :.|:|..|:   |.
Zfish   237 --NFNTQRQSKMLSSPSSSYTSQCNQQMGMGHF--------QGNKRKQDFPKRGNKLARISKSPL 291

  Fly   272 MNRG-RGADVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRDYAERLSA 335
            :... :.:|||                    ||.       ||:|:|                  
Zfish   292 LTSDIKTSDVL--------------------RGD-------FDLASV------------------ 311

  Fly   336 GGGYMDLNVYNDDADTEADAEAEGDDDSCE----DKIDVESGNEQEDSHISDSVDSAC 389
               :.|:...||....:.|.........||    .:|..:||...||       :.||
Zfish   312 ---FDDVLSGNDSTFEDLDINTALSSLGCEMEPSSQIHNQSGYSNED-------EQAC 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 50/85 (59%)
foxj1bNP_001008648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..106 6/29 (21%)
Forkhead 139..225 CDD:278670 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.