DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxd1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:174 Identity:103/174 - (59%)
Similarity:119/174 - (68%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DDSDI-------EPSSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGI 111
            :|.|:       .|.|........|.|.|.|.|.  ||||||||||||||||||||.|:||||.|
 Frog    32 EDEDLHGDLLPTSPQSSATKDPYKGTGGGGGRSA--LVKPPYSYIALITMAILQSPKKRLTLSEI 94

  Fly   112 CDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLR 176
            |:||.:|||||::|||||||||||||||||||:|:|||||||||||:|||||.:.||||||||||
 Frog    95 CEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLR 159

  Fly   177 RRKRYKR--APTM----QRFSFPAVFGTLSPFWIRKPVPLVPVH 214
            ||||:||  ||.:    .....||...:..|:.....:.|.|.|
 Frog   160 RRKRFKRQQAPELVLREPGHFLPASAYSYGPYSCAYGIQLQPFH 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 71/85 (84%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 7/30 (23%)
Forkhead 68..153 CDD:365978 70/84 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1212
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.