DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxj1.2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001008143.1 Gene:foxj1.2 / 493505 XenbaseID:XB-GENE-919738 Length:371 Species:Xenopus tropicalis


Alignment Length:286 Identity:98/286 - (34%)
Similarity:122/286 - (42%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STDPMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCS-ASSRTAAADAMSMGCDDSDIEPSSMGGSG 67
            |||    |....:..|||.::|:|        .|| .:..||:..|...|...|...|::.....
 Frog    38 STD----LSSIANSRPPLPRASQG--------PCSPPAGDTASCQAPRTGKQRSVAVPTAWASLP 90

  Fly    68 AAGGNGDGSGSSGGPL----------VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYY 122
            .         .|..|:          :||||||..||.||:..|..:|||||.|..:|...|.||
 Frog    91 T---------PSPSPVQEVDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYY 146

  Fly   123 KDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTM 187
            :...|:||||||||||||.||:||||....||||.||.:||...|||.||...|||         
 Frog   147 RHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRR--------- 202

  Fly   188 QRFSFPAVFGTLSPFWIRKPV---PLVPV-----HFNVPNFNGSREFDVVHNPADVFDSALRADK 244
                .||  ..|.|....|.:   |.:||     |.......|.|:......|..|. .||||.:
 Frog   203 ----MPA--SHLDPPRCNKAIAHHPYLPVSRPSSHHMQHISGGHRQSRRYEKPNPVL-PALRAPE 260

  Fly   245 KFNFFANAEASFY-QGSQSGDKFDRL 269
            :     ..:|.|. :....|..||.|
 Frog   261 R-----QGDALFTPEDPLQGSNFDDL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 51/85 (60%)
foxj1.2NP_001008143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..74 10/36 (28%)
COG5025 <61..>262 CDD:227358 81/230 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..99 3/27 (11%)
Forkhead 108..194 CDD:365978 50/85 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..248 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.