DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxj2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_031760837.1 Gene:foxj2 / 448174 XenbaseID:XB-GENE-483646 Length:522 Species:Xenopus tropicalis


Alignment Length:126 Identity:58/126 - (46%)
Similarity:73/126 - (57%) Gaps:15/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SDIEPSSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFP 120
            |..:||:|.....|..:.||         ||||||..||..||..:|.|::|||.|..:|...||
 Frog    49 SPTDPSAMLSKEEAAAHRDG---------KPPYSYANLIQYAINSAPAKRMTLSEIYRWICDNFP 104

  Fly   121 YYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPL-AEDMFDNGSFLRRRKR 180
            ||::....|:||||||||||.||.||||...:||||::|.:|.. .||:     .|.||||
 Frog   105 YYRNAGVGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWMIDSCPKEDV-----ALPRRKR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 46/86 (53%)
foxj2XP_031760837.1 FH_FOXJ2 68..149 CDD:410825 45/89 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.