DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and fkh

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster


Alignment Length:187 Identity:82/187 - (43%)
Similarity:104/187 - (55%) Gaps:36/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDGSG--SS 79
            ::|..:..:..||.:||..||.|.|      |.||         |:.|.||..|....||.  .:
  Fly   136 MTPSSMSYASMGSPLGNMGGCMAMS------AASM---------SAAGLSGTYGAMPPGSREMET 185

  Fly    80 GGP-------------------LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDK 125
            |.|                   ..|||||||:||||||..:|.:.||||.|..|||..||:|:..
  Fly   186 GSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQN 250

  Fly   126 FPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK 182
            ...|||||||:||.||||:|:||.|..||||:||||.|.:.:||:||.:|||:||:|
  Fly   251 QQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 21/87 (24%)
FH 210..298 CDD:214627 54/87 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445479
Domainoid 1 1.000 98 1.000 Domainoid score I1601
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.