DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxd1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_998078.2 Gene:foxd1 / 405849 ZFINID:ZDB-GENE-040426-2094 Length:343 Species:Danio rerio


Alignment Length:180 Identity:102/180 - (56%)
Similarity:118/180 - (65%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSRTAAADAMSMGCDDSDIEPSSMGGSGAAGG----------------NGDGSGSSGGP------ 82
            ||..:.|..:|   :::||:....|..|....                ||...|....|      
Zfish     4 SSEMSDASVLS---EETDIDVVGEGDDGDGHTRSYVDEVAQMHDEILLNGSPPGVDASPARDPYK 65

  Fly    83 ------LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLND 141
                  ||||||||||||||||||||.|:||||.|||||.:|||||::|||||||||||||||||
Zfish    66 PASKNTLVKPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREKFPAWQNSIRHNLSLND 130

  Fly   142 CFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR--APTMQR 189
            ||:|:|||||||||||:|||||.:.||||||||||||||:||  ||.:.|
Zfish   131 CFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELLR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 72/85 (85%)
foxd1NP_998078.2 Forkhead 74..160 CDD:278670 72/85 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577903
Domainoid 1 1.000 170 1.000 Domainoid score I3728
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm25495
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1212
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.