DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxq1b

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_998072.1 Gene:foxq1b / 405843 ZFINID:ZDB-GENE-040426-2090 Length:283 Species:Danio rerio


Alignment Length:243 Identity:83/243 - (34%)
Similarity:115/243 - (47%) Gaps:73/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GGNGDGSGSSGGP--------------LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFP 120
            |.:||.|.:|.||              ..||||||||||.|||..|...:|||:.|.:::|.:||
Zfish    16 GSDGDCSANSPGPGAPVPDGKAKPYTRRPKPPYSYIALIAMAIRDSNTGRLTLAEINEYLMKKFP 80

  Fly   121 YYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNP-GKGNFWTLDPLAEDMFDNGSFLRRRKRYKRA 184
            :::..:..|:||:||||||||||:||.|:|..| ||.|:|.|:|.:|..|.:|.|.|||||..: 
Zfish    81 FFRGSYTGWRNSVRHNLSLNDCFLKVLRDPSRPWGKDNYWMLNPHSEYTFADGVFRRRRKRISK- 144

  Fly   185 PTMQRFSFPAVFGTL-SPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRA-DKKFN 247
                     .:.|:. ||..:                           |||  ||.|.| |:..:
Zfish   145 ---------KILGSAESPERV---------------------------PAD--DSRLPARDESVS 171

  Fly   248 FFANAEASFYQGSQSGDKFDRLPFMNRGRGAD---------VLDALPH 286
            .|:::.|.        |.....|||.|.:..|         ::.|.||
Zfish   172 KFSSSFAI--------DSILSKPFMRREQSTDDTCFGTTRLMMSAAPH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 47/86 (55%)
foxq1bNP_998072.1 FH 45..134 CDD:214627 47/88 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.