DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and croc

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster


Alignment Length:372 Identity:119/372 - (31%)
Similarity:162/372 - (43%) Gaps:89/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MHTL-HDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGG 71
            |||| .|..|.:....:::.|   .|:....:|:|..:||.|.....|.....|.|      |..
  Fly     1 MHTLFSDQNSFTRHYAQTAAG---YGSASAVAAASSASAAAAAHYAYDQYSRYPYS------ASA 56

  Fly    72 NGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHN 136
            .|.|:......:|||||||||||.|||..:..||:||:||..:||.|||||:|....||||||||
  Fly    57 YGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHN 121

  Fly   137 LSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSP 201
            ||||:||:||.|:...||||::|||||.:.:|||||||||||:|:|:...|              
  Fly   122 LSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVM-------------- 172

  Fly   202 FWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFAN---------AEASFY 257
                                  ||.:.......:.:..|...|......|         |.|:.:
  Fly   173 ----------------------REKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHF 215

  Fly   258 Q-------GSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSKYK-----SPY 310
            :       |..||.:......:|...  |.|..:.|.:|.|....|.:..|..:.|.     |.|
  Fly   216 KKEPLMDLGCLSGKEVSHAAMLNSCH--DSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAY 278

  Fly   311 AF-----DVATVASA-------AGIPGHRDYAER--------LSAGG 337
            .:     ::|||||:       |....|....:|        |:.||
  Fly   279 PYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 55/85 (65%)
crocNP_524202.1 Forkhead 70..156 CDD:278670 55/85 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.