DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxa2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_989423.1 Gene:foxa2 / 395063 XenbaseID:XB-GENE-480476 Length:434 Species:Xenopus tropicalis


Alignment Length:229 Identity:84/229 - (36%)
Similarity:112/229 - (48%) Gaps:69/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SSIGN--------------GIGCSASSRTAAADAMSMGCDDSDIEPSSMG---GSGAAGGNGDGS 76
            ||:||              .:...::|....|.:|:|...::.:.||..|   |:||..|.|.|.
 Frog    26 SSVGNMNAGLSMNPMNTYMSMSAMSTSANMTAGSMNMSYVNTGMSPSLTGMSPGTGAMTGMGTGV 90

  Fly    77 GSSGGPL--------------------------------------------------VKPPYSYI 91
            .|....|                                                  .|||||||
 Frog    91 ASMASHLSPSMSPMSAQATSMNALAPYTNMNSMSPIYGQSNINRSRDPKTYRRSYTHAKPPYSYI 155

  Fly    92 ALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKG 156
            :||||||.|||:|.||||.|..:||..||:|:.....|||||||:||.||||:||||.|..||||
 Frog   156 SLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKG 220

  Fly   157 NFWTLDPLAEDMFDNGSFLRRRKRYK--RAPTMQ 188
            :||||.|.:.:||:||.:|||:||:|  :.|:::
 Frog   221 SFWTLHPDSGNMFENGCYLRRQKRFKCEKKPSLR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
foxa2NP_989423.1 Forkhead_N 17..148 CDD:369872 19/121 (16%)
FH 149..237 CDD:214627 57/87 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..339 1/6 (17%)
HNF_C 349..423 CDD:370449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.