DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxi1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_988949.1 Gene:foxi1 / 394546 XenbaseID:XB-GENE-494125 Length:373 Species:Xenopus tropicalis


Alignment Length:141 Identity:72/141 - (51%)
Similarity:84/141 - (59%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GCDDSDIEPSSMGGSGAAGGNGDGSGSSG------------GPLVKPPYSYIALITMAILQSPHK 104
            |.:.|...|.|.|.......|..|.|.|.            ..||:|||||.|||.|||..:|.|
 Frog    78 GSNTSHFMPQSYGMQRQLLPNMHGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDK 142

  Fly   105 KLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMF 169
            :||||.|..::...||:|......|||||||||||||||.||||:..:|||||:|||||..|.||
 Frog   143 RLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMF 207

  Fly   170 DNGSFLRRRKR 180
            |||:|.|:|||
 Frog   208 DNGNFRRKRKR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
foxi1NP_988949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Forkhead 123..208 CDD:365978 52/84 (62%)
COG5025 124..>308 CDD:227358 61/95 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..274 8/11 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.